PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g011752m
Common NameCISIN_1g011752mg, LOC102629672
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Dof
Protein Properties Length: 479aa    MW: 52160.4 Da    PI: 6.8315
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g011752mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.75.9e-39126185261
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                        ++k+l+cprC+s++tkfCyynny+++qPr+fCkaC+ryWt+GG++rnvPvG+grrknk+ 
  orange1.1g011752m 126 PDKILPCPRCNSMDTKFCYYNNYNINQPRHFCKACQRYWTAGGTMRNVPVGAGRRKNKNC 185
                        7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-31114183IPR003851Zinc finger, Dof-type
PfamPF027011.5E-31128184IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.826130184IPR003851Zinc finger, Dof-type
PROSITE patternPS013610132168IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MRQESKDPAI RLFGKKIAFP SDGEVPVIFS EELPSPAAKE ECSIEAEEEK AEEDSSAVKA  60
AETTQQDDTT PPNIDESKIP ESPEANVNPK TPSIDDETAK SKAAKSEKSQ NDASNSNSQE  120
KTLKKPDKIL PCPRCNSMDT KFCYYNNYNI NQPRHFCKAC QRYWTAGGTM RNVPVGAGRR  180
KNKNCASQYR HITISEALQA ARIDAPNGIS HPSVKSNGRV LSFGLDAPIC DSMASVLNLA  240
EKKVLNGTRN GFHGFQEQEI PVPCRGGENG DDCSSGSSIT VSNPMEEVGR NGMQEPLMRS  300
INGFPSPIPC LPGVPWPYPW NASVPPPAFC PSGFPMSFYP AAFWNCGIPS TWNMPWISPQ  360
SSPNQKSPSS GPNSPTLGKH SRDADMIKSE NMDKEELSKE KNRCVLVPKT LRIDDPNEAA  420
KSSIWATLGI KNESLAGGRL FKGLQSKSDE KSHMAETSPV LRANPAALSR SLNFHEST*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.86760.0callus| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00394DAPTransfer from AT3G47500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006477464.10.0PREDICTED: cyclic dof factor 3
SwissprotQ8LFV31e-126CDF3_ARATH; Cyclic dof factor 3
TrEMBLA0A067ENU30.0A0A067ENU3_CITSI; Uncharacterized protein
STRINGGLYMA17G10920.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54412848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.11e-117cycling DOF factor 3